Instruction: DIY Genetically engineered plants

Was thinking if it would sense to make a picture-based instruction on how to genetically engineer plants in a diy setting. The pictures are from the experiments I did in the Ars Electronica Lab.
To show people this is not black magic at all, and everyone can do it. Also read in the “synbio for beginners pdf” I wrote to learn how the DNA desgin is done.

Transient Transformation of tobacco with green fluorescent protein DNA:

In this experiment, we first transformed tobacco with a pGreen-derived GFP vector. Thus a gene envcoding GFP is inserted into the genetic material (chromosome) of a plant.
The plant cells then produce the green fluorescent protein. That means, if you put the plants under UV-light, the protein absorbs the UV light and emits green light.
GFP is often used as a proof-of-concept to show your transformation method worked.

http://www.pgreen.ac.uk/JIT/pGreen0000_fr.htm pGreen is a Ti-plasmid. It encodes a gene (ori) that make it replicate in bacteria (else the bacterial cell divides into two cells, and just one carries the plasmid), a resistance against the antibiotic kanamycin (so you kan kill all bacteria that haven’t taken up the plasmid by putting them into kanamycin). Then there is left border and right border (25 letters long) which are recognized by the bacterium. It ~”cuts out” the DNA between the borders and shoots it into plant cells (in our case there’s just a “always on” promoter, GFP and terminator inbetween). No other DNA is transferred, so you get a well defined outcome.

 

The plasmid DNA was inserted into agrobacterium with CaCl2-heat shock and then added some sterile LB. After one hour (time for the agrobacterium to express kanamycin resistance proteins) the bacteria were then plated out on LB-Kanamycin agar in a petri dish.

SAMSUNG

A colony was picked and transferred into LB+Kanamycin liquid medium.  The medium was then placed horizontally for 2 days to allow the bacteria to grow. The horizontal position increased the surface, so that the bacteria got more oxygen.

SAMSUNG

After two days (the bacteria multiplied in the medium), a plant was infiltrated with drops of the agrobacterium. Therefore, the tubes were centrifuged (6000 RPM, 5 minutes). The supernatant was discarded. Fresh LB was added, and some acetosyringone, and vanillin sugar, respectively. AS and vanillin are phenolic compounds, which are a wound signal of plants. Agrobacterium “smells” these compounds and the virulence genes are upregulated.

SAMSUNG

 

After 5 days, we had a look at the plant (in the box) under UV light, but saw no glowing. After 7 days we opened the box, and it was fluorescent. The magenta box seemed to have filtered out the UV light.

SAMSUNG

The leaves seem a bit reddish due to weak chlorophyll autofluorescence. The green spots are the places where agrobacterium touched the plants, there it inserted the gene for the fluorescence protein.

Shown is also a native, wild-type (untransformed) leaf, which is just red.

I was later told that usually you infiltrate the bottom of the leaves, where it has holes for breathing (stoma), while on the top it has fibers to protect it from pests (such as agrobacterium :P  ). So, my friend told me it was a miracle I got some glow anyway. Could have been a lot brighter if we had applied the bacteria solution onto the leaves’ downsides.

SAMSUNG

We infiltrated bigger plants that way, and it just worked again.

 

 

pflanze gfp

(Thanks to T. Moravec, IEB, Prague for providing the DNA).

 

Hope you enjoyed it. Try it at home, kids (unless your government doesn’t allow it).  Then try it in a lab.
Add insuline gene or whatever protein you want the plant to produce. Epo?

synthetische Biologie und Gentechnik für Anfänger

Tags

, , , ,

Gentechnik für Anfänger 1

Hier die pdf Datei (einfach anklicken) – viel besser lesbar als die Onlineversion unten (mit Farben zum besseren Verständnis)

Bitte entschuldigt die Ausdrucksweise “Dummies” :D  http://de.wikipedia.org/wiki/F%C3%BCr_Dummies

___________________________________________________________________________

http://www.welt.de/kultur/article125606862/Man-spricht-nicht-mehr-deutsch.html

Deutsch hat eindeutig seine Rolle in der Wissenschaft verloren. Ein sehr guter Artikel!

Das, unter ielen anderen Faktoren, führt uns schließlich zu diesem Problem:

http://www.welt.de/debatte/kommentare/article126487997/Warum-die-besten-Koepfe-Deutschland-verlassen.html

Viele kluge Köpfe wandern aus dem deutschsprachigen Raum ab. Ein anderer Grund ist auch, dass das „gemeine Volk“ schlichtweg Angst vor Wissenschaftlern hat. Das kommt auch davon, dass sie die Wissenschaft nicht verstehen (weil die wissenschaftlichen Arbeiten in Englisch verfasst sind? Ein Teufelskreis). In Filmen werden sie hauptsächlich als die Bösen dargestellt.

„Wenn ich auf einer Party erzähle, dass ich Vorlesungen in Kernphysikbesucht habe, dann glauben die Leute sofort, ich würde in meinem Hobbykeller Plutonium anreichern. Das stimmt natürlich, aber was ist daran so schlimm?“

 

„In einem Land, das Studiengänge für Homöopathie einrichtet, das die Angst vor Gentechnik, Elektrosmog, Pestiziden, Schutzimpfungen, Stammzellenforschung, Kernenergie und Fracking bis ins Paranoide erhöht – in diesem Land sehen viele exzellente Wissenschaftler einfach keine Perspektive mehr.“

(Zitate aus dem Artikel)

 

 

Darum übersetze ich die Einstiegshilfe „Gentechnik und synthetische Biologie für Dummies“ ins Deutsche, um meinen Teil zu tun.

 

 

Genetic engineering and synbio for „dummies“

 

Eine immer wieder gestellte Frage ist “wie kann ich mit Gentechnik anfangen?”.

Hier ist das Grundlagenwissen dazu, um über gentechnische Fragen mündig mitreden zu können.

 

Die erste Frage, die wir uns stellen müssen, ist: Wie speichert eine Zelle Informationen?

Fangen wir mit einem Bakterium an, weil es ein sehr einfacher Organismus ist (die Regeln gelten aber genau so für alle Zellen – Pflanzen, Säugetierzellen, Pilze, …).

Unser Bakterium besitzte ein sehr großes Molekül doppelsträngiger DNA (genannt das Chromosom), die die gesamte Informationen enthält, die es zum Leben braucht. Also, den Bauplan für Enzyme (Biokatalysatoren) die Zucker abbauen (um Energie zu gewinnen), um Zellulose aus einfachen Zuckern aufzubauen, die Fettsäuren in Fett-Esther (z.B. für Verrwendung in der Kosmetik oder als Biotreibstoff) umwandeln, und tausende anderer Enzyme.

Bakterien können aber auch Plasmide tragen. Plasmide sind kleine, ringförmige DNA Moleküle (also quasi Mini-Chromosomen) und enthalten Informationen, die fürs Leben nicht  unbedingt notwendig sind – aber sie können z.B. Antibiotikaresistenzen tragen.Oder andere vorteilhafte Gene. Am besten lässt sich die Analogie zum Computer beschreiben:

Das Chromosom ist die Festplatte des Computers, die alle wichtigen Informationen (Systemdateien von Windows/Linux/ etc. ) enthält und ohne die der Computer nicht geht. Und Plasmide sind wie USB Sticks, sie tragen nur kleine Mengen an Informationen und sind zwischen mehreren Computern hin- und her austauschbar.

 

Jetzt die wichtigste Information: Der einzige Sinn und Zweck der DNA ist es, Proteine (lange Ketten von Aminosäuren, Daumenregel 200-300 Aminosäuren hintereinander ergeben ein Protein) herzustellen.  Die DNA macht praktisch nichts anderes, sie ist nur ein Code der Informationen speichert. Die erzeugen Proteine können dann z.B. als Enzyme arbeiten  (um  Substanz A in Substance B  zu verwandeln – z.B Zucker in Biodiesel, oder Zellulose zu Glucose abbauen), ein paar besondere Proteine leuchten stark wenn man sie mit UV-Licht anleuchtet, und andere Proteine werden als Stützmateriale der Zelle verwendet (Sprich mechanisches Baumaterial), etc.  Menschliches Wachstumshormon ist ein Protein, oder EPO (um besser Radfahren zu können).

 

Also – fangen wir mit der praktischen Arbeit an. Dafür nehmen wir ein Bakterium, das gut erforscht ist und nicht Krankheitserregend. Wie z.B. einen sicheren Laborstamm von E.coli. Diesem wollen wir jetzt den genetischen Bauplan für ein grün fluoreszierendes Protein (GFP aus einer Qualle) einbauen. Wenn das Bakterium unseren Bauplan aufgenommen hat, und wenn es den Bauplan auch umsetzt, dann wird das Bakterium unter UV-Licht grün leuchten . und wir sehen, dass unser Experiment funktioniert hat (weil ein normales Bakterium daneben nicht grün leuchtet).

 

Ein DNA-Strang ist eine Aneinanderreihung der vier Basen: A,T,G,C.

Der Bauplan für GFP ist folgender:

atgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

Die DNA (Speichermedium) wird zuerst abgelesen und eine RNA (Arbeitskopie) mit der selben Sequenz erzeugt (die Arbeit erledigt die RNA-Polymerase). Die DNA wird in Richtung 5‘ -> 3‘ abgelesen – das muss man zu diesem Zeitpunkt aber noch nicht verstehen. Sprich, die Polymerase weiß aufgrund unserer Sequenz in welche Richtung sie welchen Strang ablesen muss.

Diese RNA wird aus unserer GFP-DNA erzeugt.

 

AUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

 

Jetzt wir daraus Protein erzeugt. Die Ribosomen erledigen die Arbeit und lesen die RNA ab als

AUG-AGU-AAG-GGA-GAA-GAA-CUU-UUC-ACU-GGA-GUU-GUC-CCA-…. und so weiter.

 

Nach diesem Bauplan erzeugen die Ribosomen, Aminosäure nach Aminosäure, eine lineare Aminosäurekette (Die sich dann aufgrund der Zusammentsetzung zusammenfaltet – bestimmte Aminosäuren ziehen andere an usw. Für uns jetzt unwichtig, da wir ja wissen das das Protein in der Natur mit diesem Bauplan funktioniert!). ATG heißt “Start” und codiert für die Aminosäure Methionine (m). Das Ribosom gleitet dann zum nächsten Triplet  (“Codon”) AGU. Das codiert für  die Aminosäure Serin (s). Dann kommt AAG welches das Ribosom als die Aminosäure Lysine (k) erkennt. …etc.

Urheberrechtlich ungeschütztes Bild von “codon wheel” einfügen.

m-s-k-g-e-e-l-f-t-g-v-v-p-… und so weiter

Wir bekommen also eine Aminosäurenkette (ein Protein) mit dieser Zusammensetzung:

mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttfayglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk

Die Protein Synthese startet immer mit einem ATG. Und stoppt bei TAG, TAA oder TGA.

 

 

Soweit sind wir durch  – das war die große Hexerei, wie Lebewesen funktionieren und wie Gentechnik funktioniert. Im Groben.

 

Nun müssen wir noch eine Ribosomen Bindungsstelle (hier rot eingezeichnet) einfügen. Diese muss kurz vor dem ATG sein. (zumindest aber 4 basen/”Nucleotide” weit weg!). Die “consensus sequence” (~in der Natur am häufigsten) dafür ist AGGAGG. Also fügen wir hinzu:

 

TCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

 

Das ganze wird dann zu RNA:

 

UCAGGAGGUAGUAAUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

 

Die exakte Sequenz der anderen Basen (schwarze Buchstaben) spielt eigentlich keine Rolle, sie dürfen nur nicht zu stark mit der  ribosome binding site (vermeide eher  C und T) interagieren (sonst verflechtet sich die RNA und wird nicht abgelesen).

Jedenfalls, die „Untranslated RNA“, also der Anteil der nicht zu Protein abgelesen wird trägt nichts zu der Sequenz – also auch nicht zur Funktion – des Proteins bei.

Höchstens dazu, wie oft die RNA abgelesen wird – dh. Wie viel Protein wir bekommen.

 

Jetzt wo wir diese RNA in unserer Zelle haben,die eine Ribosomen Bindungsstelle enthält, wird nach deren Vorbild ein Protein erzeugt, dass unter UV-Licht grün leuchtet (fluoresziert).

 

Das letzte Bisschen, was wir noch brauchen: nicht jede DNA wird auch zu RNA abgelesen. Das selbe, wenn man einen Bauplan für einen Stuhl zum Tischler bringt – das heißt nicht, dass er auch zu Arbeiten beginnt. (Die Information (DNA) liegt erst mal herum und wird nicht abgelesen). Man muss dem Tischler sagen, dass er zu Arbeiten anfangen soll. Und wieviele Stühle man braucht.

 

Nicht jede DNA wird auch zu RNA abgelesen.Was uns noch fehlt ist ein Promoter. Ein Promoter ist eine Spzielle DNA Sequenz, die der DNA eine spezielle Struktur verleiht, an die die RNA-Polymerase binden kann. Die  Polymerase liest dann die DNA ab und erzeugt RNA mit der entsprechenden Sequenz. Der Promoter sagt der Zelle auch, zu welchen Zeitpunkt das dahinterliegende Gen angeschaltet wird. (inducible Promoter / oder „always on“): Kein Promoter heißt „Nie an“.. Ein “konstitutiver” Promoter heißt “immer an”. Lactose-induzierbarer Promoter heißt “nur an, wenn in der Zelle Milchzucker ist”. Etc.

Schlussendlichbnraucht man dann noch einen Terminator – das ist eine Struktur,  die der RNA polymerase sagt, sie soll aufhören RNA zu machen. Sonst würde ja die gesamte DNA abgelese werden, und noch dazu ist sie ja Ringförmis, dh. die Polymerase würde ständig ablesen und idas gesamte Genom mehrmals umkreisen.

 

Damit haben wir unser fix-fertiges Konstrukt, das man in Bakterien verweden kann, um das Protein zu erzeugen:

Promoter- ribosome binding site- ATG – code – TAG – Terminator.

 

Ein constitutive promoter (von iGEM) ttgacagctagctcagtcctaggtattgtgctagc.

 

Also nehmen wir: ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

 

Das erste, dunkelgrüne Segment ist der Promoter. Die blaue Sequence ist “untranslated region” (RNA die nicht zu Protein abgelesen  wird). Außerdem haben wir noch ein paar Basen hinzugefügt. tctaga ist eine Sequenz, die von einem Restriktionsenzym erkannt wird – XbaI. Dieses schneidet die DNA nur an den vorherbestimmten Stellen  (hilfreich wenn man nachher z.B. noch einen anderen Promoter anhängen will)

 

Ein Terminator, der in E.Coli funktioniert, ist:

AGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

http://parts.igem.org/Part:BBa_B0011 here you see the structure of it. AAAA binds to TTTT and somehow transcription of DNA into RNA is aborted. Es bildet sich irgendwie eine Schleife zwischen den AAA und TTT und damit hört die Transkription auf. Zerbrechen wir uns jetzt mal nicht den Kopf darüber, wie genau das funktioniert. Es funktioniert, darum können wir es verwenden ;) Falls das jemanden interessiert, einfach nach „rho-independent terminator“ googlen.

 

 

Somit haben wir

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

 

In dieser Form kann die Zelle die DNA lessen und in RNA ablesen und diese in Protein ablesen.

Kurz: Polymerase bindet an den promoter structure, und startet RNA Synthese. RNA Synthese stoppt beim Terminator. Jetzt haben wir einen RNA Strang, der in der Zelle herum”schwebt” bzw treibt. Irgendwann trifft ein Ribosom auf die RNA und bindet an die ribosome binding site , und findet daraufhin das ATG. Dort beginnt es mit der Protein Synthese. Viel RNA (starker Promoter) heißt, man bekommt viel Protein.

 

Das Protein ist es, was wir wollen.Es erfüllt die biologische Funktion – also z.B. Leuchten unter UV-Licht, oder als Enzym (Katalysator) um Substanzen (wie Zucker, Fette, …) umzuwandeln in andere Substancen. Oder die Proteine fungieren als Hormone (Man denke an Insulin).

Wenn man will, dass man das selbe Protein jetzt nicht in E.Coli sondern in Bacillus subtilis erzeugt, tauscht man einfach den E. coli Promoter gegen einen  Bacillus promoter (und Terminator, für den Fall, dass der E.coli Terminator in Bacillus nicht funktioniert). Wenn man will, dass es in Pflanzen funktionioert, fügen man einen Pflanzen Promoter und Pflanzen Terminator hinzu. (Und die ribosome binding site sollte ein bisschen anders aussehen: Kozak sequence – um viel Protein zu erzeugen)

 

 

 

 

Nun muss man die DNA nurmehr in ein Bakterium bnringen.  Sobald es in der Zelle drinnen ist, wird die DNA erkannt.

Allerdings haben wir hier jetzt ein lineares DNA Molekül. Teilt sich das Bakterium, dann wird diese lineare DNA nicht mitvermehrt. Das Bakterium teilt sich in zwei „Tochterzellen“ von denen dann nur eine unsere DNA tragen würde.

Außerdem:Zellen mögen keine lineare DNA (Virusverdacht!) und bauen diese sofort gezielt ab (beginnend an den freien Enden). Darum schneidet man die DNA in ein naürlich vorkommendes Plasmid, dann bleibnt die DNA in der Zell stabil und wird gezielt mitvermehrt. (Das Plasmid hat dazu einen “Replication Origin” oder Vermehrungsstartpunkt. Dort kann DNA Polymerase ansetzen und das Plamsid vermehren). Außerdem tragen Plasmide oft eine Antibiotikum-Resistenz, dass man die Zellen damit selektieren kann.

 

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgNNNNNNNNtaaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

 

So könnte unsere Antibiotikumresistenz aussehen:  NNNN steht für den gentischen Code des Enzymes, das das Antibiotikum in eine ungifitige Substanz umwandelt bzw. zerstört.

 

 

Wie bringe ich dieses neue (rekombinante) Plasmid jetzt in ein Bakterium? Mit einer feinen Nadel reinstechen, wie es der Volksmund gerne glaubt?

Nein, einfacher. Man hat eine Lösung mit Millionenn von identen Plasmiden, und eine andere Lösung mit Millionen von Bakterien. Denen gibt man dann einen kurzen Hitzeschock (bei 42°C), dabei gehen ihre Zellwände auf und die DNA kann einfließen. Von den Millionen Bakterien hat aber nur ein kleiner Teil, sagen wir 100 Zellen, das Plasmid aufgenommen. Sprich wir haben 100 Zellen die leuchten (oder Insulin  produzieren) unter Millionen die „natürlich“ sind und die DNA nicht aufgenommen haben.

Dafür haben wir jetzt unsere Antibiotikumresistenz. Setzen wir die Millionen von Bakterien diesem Antibiotikum aus – sterben alle ab bis auf die Bakterien, die das Plasmid tragen. Diese vermehren sich dann – und vermehren auch das Plasmid mit.

 

Plasmide sind allerdings nichtextrem stabil – man muss die Bakterien immer im Antibotikum-haltigen Nährmedium halten, sonst geht irgendwann das Plasmid verloren. Dann ist die Bakterienzelle auch wieder empflindlich gegen das Antibiotikum.

Genetic engineering and synbio for newbies

Here’s a guide of some basic genetic engineering and synthetic biology for „dummies“ / noobs / beginners – how to getting started. In the future I intend to add some pictures (hand drawn not to infringe any IP) genetic-engineering-and-synbio-for-beginners v1  (click for the pdf document, the document shows the sequences in colours and is better readable)

On the diy bio mailing list a very frequent question is: where can I start? What can I read?

So here are some basic guidelines.

First question we need to ask: How does a cell store information? Let’s start with a bacterium. Our bacterium has a very large circular molecule of DNA (called chromosome) which contains all the information it needs. How to make enzymes that degrade glucose, make cellulose from simple sugars, and other metabolic enzymes. Bacteria can also carry plasmids, which are small molecules of DNA (like very small chromosomes) which are not necessary for living – but they can carry antibiotic resistances or other genes that are favourable. Think of it as the chromosome is the hard drive of the computer, where all the necessary information is stored. And plasmids are like USB sticks, which only carry small amounts of information and are mobilizable to transfer information between different bacteria.

The only purpose of DNA is to make proteins. DNA itself has no function other than saving information. Proteins can act as enzymes (to convert substance A into substance B – for example convert sugar into biodiesel, or digest cellulose into glucose), special proteins glow under UV-light, and some proteins act as a construction material, etc.  

Got all that information inside your mind? That’s the basic knowledge we’re gonna use now.

So we take a bacterium that is well studied and not pathogenic. Like a safe lab strain of E.coli. Now we want to introduce DNA that codes for a green fluorescent protein.

DNA is made of the four different bases A,T,G,C.

The construction plan for GFP is this:

atgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

The DNA firstly is translated into RNA (by polymerase), a working copy from which proteins are synthesized. RNA -working copy of the construction plan:

AUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

The ribosomes then read this as

AUG-AGU-AAG-GGA-GAA-GAA-CUU-UUC-ACU-GGA-GUU-GUC-CCA-…. and so forth.

The ribosomes then produce protein (a chain of amino acids) out of it. ATG always means “start” and codes for the amino acid methionine (m). The ribosome then slides to the next triplet (“codon”) AGU. This means serine (s). Next comes AAG which the ribosome translates into lysine (k). …etc.

Attach a picture of the codon wheel.

m-s-k-g-e-e-l-f-t-g-v-v-p-… and so forth.

yielding:

mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttfayglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk

Protein synthesis always starts with an ATG. And stops at TAG, TAA or TGA.

What we then need for the ribosome to start is: a ribosome binding site before the ATG shortly before the ATG (but at least 4 bases/nucleotides away and no more than 14 bp away!). The consensus sequence is AGGAGG. So we add

TCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

which is then translated into RNA:

UCAGGAGGUAGUAAUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

The exact sequence of the other bases (shown in black) are not really important, they just should not interfere with the ribosome binding site (avoid C and T). It doesn’t get translated, so it won’t influence the cell in any way, though.

Now that we have this RNA in the cell, which includes a ribosome binding site, it gets translated into a protein which glows green under UV-light.

Last bit we need: Not all DNA is transcribed into RNA. What we need now is a promoter. A promoter is a sequence which confers a special structure to the DNA to which a RNA polymerase can bind to. The polymerase then reads the DNA and makes RNA with the corresponding sequence. The promoter also tells the cells when the gene is expressed (“on”): No promoter means never. Constitutive promoter means always. Lactose-Inducible promoter means only in the presence of lactose our gene is expressed… And, at last, a terminator, which is a structure which the RNA polymerase stops to make RNA.

So, finally we have or ready gene which can be expressed in bacteria:

Promoter- ribosome binding site- ATG – code – TAG – Terminator.

A constitutive promoter (from iGEM) ttgacagctagctcagtcctaggtattgtgctagc. So we take ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

The first green part is the promoter. The blue sequence is untranslated region (RNA which is not translated), we just added some nucleotides. tctaga is a site where a restriction enzyme called XbaI can cut the DNA, so you can cut the DNA at exactly this specific site (if you want to attach another promoter which had the same restriction site added.

A terminator that works in E.Coli is

AGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

http://parts.igem.org/Part:BBa_B0011 here you see the structure of it. AAAA binds to TTTT and somehow transcription of DNA into RNA is aborted.

Finally, we have

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

This is our gene how the cell can read it. Polymerase binds to promoting structure, and starts RNA synthesis. RNA synthesis stops at the terminator. Now we have a RNA string which floats in the cells interior. A ribosome sometimes will encounter our RNA, bind to the ribosome binding site and find the ATG. And start protein synthesis. Much RNA (strong promoter) means you get much protein.

The protein is what we want. Because it may glow under UV light, or act as an enzyme to convert substances (like sugars, fats, …) into other substances. Or act as hormones (think of insulin).

If you want it to work in Bacillus subtillis, add a Bacillus promoter (and terminator, in case this one wouldn’t work) to it. If you want it to work in plants, add a plant promoter and plant terminator. (And the ribosome binding site should look a bit different for high expression: Kozak sequence)


You then have to bring this DNA into a bacterium. What we would have now is a linear DNA molecule. When the bacterium divides, this linear DNA fragment would not replicate with it, so only one cell would have it. Plus, the cell does not like linear DNA, recognizes the free ends, and would digest it immediately. Therefore you usually cut it into a plasmid (that carries a replication origin to be able to replicate the DNA in the cell). And, usual plasmids often carry an antibiotic resistance, so by adding the antibiotic you can kill all the cells which don’t have taken up the DNA.

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgNNNNNNNNtaaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

And this might be how the antibiotic resistance looks like. NNNN stands for the coding site of the resistance protein. It also needs all the regulatory elements we just learnt.

transient GFP transformation (agroinfiltration) worked!!

Finally found out our transformation worked!!

First pictures: They were taken without filters so they are rather unspectacular. But still, you can see the green spots where GFP has been inserted.

The leaves appear a bit reddish dur to chlorophyll autofluorescence.SAMSUNG SAMSUNG SAMSUNG SAMSUNG

 

Note: on two fotos a single leave is shown. It appears totally dark/red, as this is untransformed, so all cells are native.

Transfecting tobacco plants with GFP @ AEC

After recieving a GFP-construct in a Ti-plasmid, we are transiently transfecting GFP plants.

The recombinant plasmid is then put into agrobacterium (by heat shock transformation) and the bacteria are cultivated in liquid medium (plus selection antibiotic). After two or three days, the bacteria have propagated enough, are centrifuged and resuspended in fresh LB medium, and they ar ethen put onto a plant. After 5-7 days, the plant shold look like this:

Foto by T. Moravec, IEB, Prague foto by T. Moravec, IEB, Prague

Thanks to T. Moravec, IEB, Prague for providing the fotos.

Everywhere, where agrobacterium touched the plants, it has inserted the gene for the green fluorescent protein into the plants genome, and the plant emits light from these spots under UV light. (The bacteria afterwards are killed of with ethanol or antibiotic or bleach)

Thus the plants are not really glowing yet, because you need UV light. But a nice show object where the journey is going. And in this particular case, it’s a genetic mosaic plant, as by far not every plant cell contains the new gene.

The pGlowroplast backbone hopefully will arrive soon from synthesis, then itÄ’s about engineering real glowing plants!

Found old, unposted Pics of pVIB

Some light was shining in from the streetlights at university, still the glow was visible.  

  Petri disk alight hand Petri disk alight6

Here’s an actual map of pVIB that shows the Insert (from Vibrio Fischeri genomic DNA) between the two SalI sites. It was inserted into the SalI site from pBR322, disrupting the Tetracyclin resistance gene. BglII cuts within the luxI coding site (in the green line), so the Ribosome binding site of LuxC is still intact. Thus by restiction with SalI and BglII you get a functional LuxCDABEG casette. Just attach a constitutive promoter before it (BglII), to get constitutive expression. Or a chloroplast promoter, to get glowing chloroplasts. Only one thing is annoying – there is a transcription terminator directly after LuxG (between LuxG and SalI site). No restriction site inbetween to cut away the terminator.

The green fragment (~1700 bp) contains a cell density induced Promoter, and the LuxI gene, and LuxR in the opposite direction. The native Lux cassette constantly produces the LuxR protein, and small amonuts of LuxI (which is an enzyme that produces the autoinducer). The autoinducer diffuses throgh the cell wall into the medium, and to some extent also in other cells. At high cell densities, much autoinducer is in both the medium and in the cell. The autoinducer binds to LuxR protein which then activates strong expression (1000-fold the constitutive expression) of the LuxICDABEG operon. (LuxI is then also  expressed at higher levels).

pVIB restriction (2)

Someday I will retransform pVIB and then add myristic acid to the petri dish. That should enhance the glow significantly. pVIB on steroids :D

Pictures of glowing Panellus Stipticus

The fotographs in the dark were taken by Andreas Tanda. Many thanks to him, as it is quite difficult to get the glowing on a foto.

Holz_1

This is a wood log which carries many fruiting bodies.

Panellus Stipticus Collage

Night/Daylight

Glas_1

Here you see the mycel glowing weakly, while the fruiting bodies glow strong… However, when you wake up in the middle of the night, it looks even more awesome, because you really see the paterns of the mycel glowing. Quite the entire structure in the jar glows, but only weakly.

Holz

Again, the wooden log.

A bit strange is, that when you see it with your eyes, I’d rather say the glowing is greenish blue, while on the fotos the emitted light appears totally green.

Follow

Get every new post delivered to your Inbox.