Warum Biotechnologie die Grippe und den Krebs noch nicht besiegt hat

http://www.strike-the-root.com/51/walker/walker6.html

“Column by Bill Walker, posted on April 20, 2005
in

Other

I shovel telomeres for a living. My friends in the computer industry are always asking me: ‘Why can’t you biotech guys cure cancer? Or aging? Or the common cold? What do you do with all those billions of government research dollars?’

Well, it’s time to confess: Biologists bought three stuffed mice and two petri dishes in 1974. These are recycled in staged publicity photos in such high-profile popular glossies as Proceedings of the National Academy of Sciences, Cell, and Eur J Gastroenterol Hepatol. Our much-hyped ‘gene sequencing,’ ‘chromosome imaging,’ etc. are all done on Photoshop by companies in Taipei . All the rest of the money goes to yachts, scuba equipment, and private islands in Fiji for all postdocs and research associates. That’s why medical researchers always look so tanned and vigorous.

OK, seriously: If the computer industry were running under the same conditions as biotech, this is how it would work:

There would be a Federal Data Administration (FDA). Every processor, peripheral, program, printer, and power cord made in or imported into the USA would have to obtain FDA approval. This would require an average of 19 years of safety testing on lab rats and clinical trials for effectiveness on nerd volunteers with informed consent, before prescription for general human use is allowed. Any change of any kind to any chip, ergonomic keyboard, or line of code would require re-approval of the entire system and any hardware or software that could in principle be connected to it via Internet, intranet, or hand-carried disk.

In the medical system, this sort of approval can be done for only a bit over $802 million per drug or medical device (Tufts study, 2001). So it might cost only a few times more when applied to a global industry producing next-generation silicon chips. Anyway, how can anyone put a price tag on safety? Think of the children!

Today even someone who dropped out of college could legally own a large software company. To remedy this unconscionable state of affairs, state licensing boards would be created to require American Mainframe Association (AMA) membership for all computer professionals. This would ensure that all programmers go to college and postgraduate school for at least eight years, and then serve multi-year nerdships and residencies before being allowed to practice independently. Thus programmers would be fully prepared to start writing BASIC programs by age 28-30, and attain full professional status by their 40s.

These AMA professionals would prescribe for consumers the ‘right’ hardware and software (within the prescribing and cost limits of the appropriate HMO, see below). To guard against improper (‘recreational’) use of computers, all information products would now require a prescription from a professional.

A Data Enforcement Agency (DEA) would be empowered under the asset forfeiture laws to confiscate the property of smugglers and users of illegal data processing paraphernalia, such as that used in so-called ‘video games’ or ‘palm pilots.’ The DEA would also have the responsibility of ensuring that no unapproved data flows in or out of our borders.

Then the IRS would make buying computers for the home use of employees a deductible expense for employers (but not for employees), as is true of health insurance today. Companies would be forced to buy computers for their employees through Hardware Maintenance Organizations (HMOs), instead of allowing the employees to buy them directly.

Finally, the Federal government would hire hundreds of thousands of programmers and chip designers to work in government-run ‘computer research,’ controlled by NIH, the various armed services, and other fountains of innovation. Private ‘cybertech’ companies could have whoever was left over . . . if they could figure out how to con investors into funding companies which were rarely allowed to sell their products.

If we had really let government run the computer industry this way, there would be no Intel, IBM or Apple. There would be no chip industry. There would be no Internet. The NIH would be funding hundreds of labs to develop better vacuum tubes.

Now, all you programmers who are snickering at the poor dumb biologists: let me point out something. You, personally, aren’t made of doped silicon. You are made of DNA and some other junk banging around inside lipid bilayers. If you want to improve your life in any meaningful way, you need to be able to buy stuff to upgrade your DNA system.

Some organisms, like Bowhead whales, already manage to make DNA systems work for over 200 years. That means their cancer control is 1,000 times as good as ours (twice the lifespan times 500 times the cell number), and their aging control is at least twice as good. A real free-market biotech industry could pirate these already-existing DNA programs and sell them to you cheap (whales don’t get royalties, and DNA replicates as easily as chips do).

So, since you computer guys have all the money, it would behoove you to use a little of it to get rid of the FDA and all the rest of the medieval guild nonsense that encrusts the biotech industry. Then you would finally see some progress against cancer and aging.

Oh, the common cold? We could wipe out the existing varieties, but RNA and DNA hackers will always resequence new types. Viruses will always be with us; you just have to continuously update your immune system’s definitions. “

“Natürlich” vs “Chemisch”

Es ist als Wissenschafftler furchtbar traurig zu lesen, wie Leute die Chemie verunglimpfen. Medizin die “pflanzlich” ist, wird als gut und gesund und arm an Nebenwirkungen gesehen, während “chemische Stoffe” als böse angesehen werden und von der bösen Pharmaindustrie gemacht werden, um uns zu schaden.

Was die wenigsten Wissen a) viele der “chemischen Medikamente” kommen ursprünglich aus Pflanzen. Nur leider kommt es da häufig vor dass das Blatt einer Pflanze mal 1 mg eines Wirkstoffes enthält, und das Blatt der Pflanze daneben gar 50 mg. Aussagekräftige Studien können aber nur gemacht werden (und Effekte erzielt) wenn man Tabletten hat, in denen jeden Tag das selbe (z.B. 20 mg) drinnen ist.
Darum werden aus dem Stoffgemisch (in jedem Pflanzenbatt sind 1000e verschiedener Chemikalien drinnen) einzelne Stoffe (“Chemikalien”) aufgereinigt und auf bestimmte Gehalte in Tabletten gepresst.

b) “Natürliche” Heilmittel machen bei weitem den größten Profit für Apotheken. Antibiotika werden in der Regel fast zum selbst-kostenpreis erzeugt. Darum haben Pharmafirmen seit ca 20 Jahren keine neuen Antibiotika auf den Markt gebracht.

Medizin zu erzeugen ist extrem aufwendig. Zuerst muss ein Medikament entdeckt werden. Das “Screening” vieler verschiedener Stoffklassen geschieht oft in Mäusen. Dann gibt es Studein am Menschen, zuerst beweist man die Sicherheit (keine Vergiftung von dem Stoff bei eingesetzten Dosen), dann die Effektivität (hemmt der Stoff das Grippevirus?). Bis ein Produkt auf den Markt zugelassen wird, dauert es 12 Jahre und viele, viele Millionen Dollar (wieviele? Muss mal googlen). Im Produktionsprozess, alleine die Maschinen und Reaktoren müssen laut Gesetz gewährleisten, dass man reines Produkt bekommt. Nur am Schluss zu messen, was herauskommt (z.B: mittels HPLC) ist nicht zulässig. Wenn der Gehalt an Wirkstoff ein bisschen abweicht, muss die ganze Charge (zB Tagesproduktion oder Wohenproduktion) vernichtet werden. Das alles, um dem Konsumenten Sicherhiet zu geben, dass sein Medikament sicher und effektiv ist.

Jetzt gibt es eine Ausnahme im Medizingesetzt. “Hausmittel” dürfen frei verkauft werden. Das heißt, ich nehme eine alte Pflanze, zum Beispiel Urgerste oder Erdbeeren und schreibe darauf “altes Hausmittel gegen Husten”. Das ist völlig legal.

Was ich vor einiger Weile in einer Apotheke sah: Eine Frau kam herein und meinte “ich brauch etwas gegen Husten für mein Kind”. Der Apotheker meinte “da habe ich zum Beispiel das hier” und zeigte auf eine Packung für 9,90€ daraufhin die Frau: “ist das eher was natürliches?” “Nein, da haben wir das”, meinte der Apotheker und zeigte auf eine Schachtelhalm-Saftflasche für 25€. Sofort nahm die Frau das. Ich verkniff mir, mir an den Kopf zu greifen. Den Apotheker hats sicher gefreut – mehr Profit gemacht.

Nun bin ich keineswegs gegen pflanzliche Medizin – die meisten unserer Medizinischen Stffe wurden ja in Pflanzen entdeckt. Oftmals auch kommen in Pflanzen Wirkstoffkombinationen vor, die besser wirken als nur eine Reeinsubstanz. Aber nur weil es “natürlich” ist, das Produkt automatisch dem “chemischen” vorzuziehen ist einfach nur dumm.

Zu den Risiken von Gentechnik

Leider wird keine sachliche Debatte geführt. Laut dem Gentechnikgesetz gelten radioaktiv bestrahlte Samen nicht als Gentechnik – nachher schaut der Züchter an ob die Äpfel größer oder röter sind. Die hunderten von Gene, die dabei von der Strahlung völlig zufällig mutiert werden – unvorhersehbare Effekte! – sind dem Gesetzgeber scheinbar völlig egal. Solche Pflanzen brauchen keine extra Zulassung.

Aber auch traditionelle Kreuzung ist nicht ohne Risiken. Bei der sexuellen Kreuzung zweier Sorten werden rund die Hälfte der Gene von Vater und Mutterpflanze bunt durcheinandergewürfelt. Transposons springen im Genom herum. Antike Retroviren  werden vielleicht aktiv. Traditionelle Züchtung hat bei Kartoffelsorten schon einmal zu einer Sorte geführt, die toxisch für den Menschen war.

http://www.gute-gene-schlechte-gene.de/gift-gene-zuchtung-lenape-kartoffel/

In gentechnisch veränderte Pflanzen wird nur ein einziges Gen (oder ein paar Gene) eingebracht, dessen Funktion genau bekannt ist. Man kann im Vorherein bereits abschätzen, ob es Risiken im Bezug auf Umwelt und Gesundgheit gäbe. Mittels Fütterungsstudien an Tieren wird dann noch bewiesen, dass diese Pflanzen unbedenklich sind. Trotzdem gibt es dann immer noch Schreier, die den Leuten Angst einjagen vor Genpflanzen. Und sinnvolle Projekte wie Golden Rice behindern, lobbying betreiben dass ihre Finanzierung gestrichen wird, um Jahre verzögert, und dann deren Testfelder zerstampft.

 

Oft argumentiert wird auch mit dem naturalistischen Fehlschluss. Werbung will uns weißmachen, alles natürliche sei gut. Und da viele Menschen heute weit weg von der Natur leben, klingt das auch einleuchtend. Wir romantisieren die “gute Natur”. Im Mittelalter war die Natur angsteinflößend und gefährlich für die Menschen, da reale Gefahren von natürlichen Seuchen, Raubtieren, etc. bestanden hatte.

Man denke nur an giftige Pilze, Krankheiten, etc. Das ist alles “ganz natürlich”. Trotzdem sind das zweifelsohne schlechte Sachen. Ein Doktor, der einem Herzinfarktpatienten das Leben rettet – spielt der Gott? Hätte der erwähnte Mann nicht von Natur ausd sterben müssen? Menschen mit körperlichen Behinderungen werden von der Gesellschaft mitgetragen, auch wenn sie in freier Wildbahn nicht überleben würden. Das ist unnatürlich – und trotzdem wuird keiner sagen, das sei unnatürlich und schlecht.

Golden Rice – DIY

Dieser Post soll den Prozess aufschlüsseln, wie man Reis genverändern kann, sodass er VitaminA erzeugt „Golden Rice“. Die Idee für diesen Artikel kam von einer Podiumdiskussion der Friedrich-Ebert Stiftung, zu der ich eingeladen bin. In dieses Beispiel werde ich auch ethische Fragen, die damit verbunden sind, einflechten.

Der Goldene Reis produziert Beta-Carotin, also den direkten Vorgängerstoff von VitaminA- Jednen Tag sterben 20‘000 Menschen an VitaminA Mangel (ein furchtbarer Tod, weil man zuvor daran blind wird). Warum wir den Reis nicht gleich Vitamin A direkt produzieren lassen? 1) der menschliche Körper kann Vitamin A aus b-Carotin erzeugen, also wäre es unnötig, das  Gen in die Pflanze einbauen.  2) Isst man zuviel VitaminA, kann das schädlich für den Körper sein. Isst man zuviel b-Carotin, wird der Überschuss mit dem Urin ausgeschieden.

https://www.ncbi.nlm.nih.gov/nuccore/X78814

https://www.ncbi.nlm.nih.gov/nuccore/22474502

https://www.ncbi.nlm.nih.gov/nuccore/1419692

Dies sind die genetischen Baupläne für einen Vitamin A Stoffwecheslweg.

Wir brauchen die drei Gene – Psy, Crtl, Lyc.

vita-pathway.jpg

Auszug aus dem open access Paper from der American Society for Nutritional Sciences

Pflanzenzellen enthalten bereits GGPP (Geranylgeranyl pyrophosphate) – welches ein ziemlich wichtiges, zentrales Glied im Stoffwechsel ist, das mittels Enzymen in viele andere Stoffe umgewandelt werden kann.

Wie an dem Bild ersichtlich, müssen wir in den Reis ein Gen einbringen, dass das Enzym „Phytoene Synthase“ codiert. Dieses Enzym verwandelt das Zelleigene GGPP der Pflanze in Phytoene.

Weiters wollen wir das entstandene Phytoene in Lykopen (Lycopene ist ein gesunder Stoff in z.B. Tomaten) umbauen. Dazu verwenden Pflanzen normalerweise zwei Enzyme – allerdings haben Forscher in einem Bakterium ein Enzym gefunden, dass diese zwei Schritte auf einmal machen kann.

Als letzten Schritt brauchen wir noch ein Enzym, dass das entstandene Lykopen weiterverarbeitet zu b-Carotin. Das Enzym heißt lycopene cyclase.

Enzyme sind Biokatalysatoren, die extreme spezifisch wirken. Jedes Enzym erfüllt nur einen Job – der Stoff, den das Enzym verändert passt in das aktive Zentrum des Enzymes und wird dann umgebaut. Das ist im völligen Gegensatz zu Reaktionen in der technischen Chemie, wo Stoffe oft bei 120°C in Schwefelsäure gekocht werden, und sich dann Stoffgemische (Isomere bilden). Die Medien behaupten immer, Gentechnik hätte irgendwelche unvorhergesehenen Effekte haben – aber in dieser Hinsicht gibt es die definitiv nicht. Mit molekular Modelling Software kann man sogar am Computer berechnen, welcher Stoff an welches Enzym bindet.

 

 

Kleine Abschlussnote von der biotechnologischen Seite. Die Foscher haben in dieser wissenschaftlichen Arbeit die Enzyme in die Chloroplasten gebracht (vermutlich weil da das meiste GGPP ist), mittels Signalpeptiden. Zur Vereinfachung wurde das einmal weggelassen.

Am Schluss ware noch zu erwähnen, dass unsere Ur-Ur Ahnen einmal deren eigenes VitA erzeugen konnten. Wir haben die Enzyme noch in unserer chromosomalen DNA, aber im Laufe der Evolution hatten wir eine Mutation in einem Gen, worauf dessen Struktur verändert wurde und das Enzym nichtmehr aktiv war. Nun ist es nicht so wie in Horror-Filmen, dass  solche Mutationen die Menschen in Zombies oder Vampire verwandeln. Das Enzym wurde weiterhin erzeugt, ist aber quasi eine Leiche, ein Relikt der Evolution und kann keine Aufgabe in der Zelle mehr tun – schadet aber ihr aber auch nicht (bis auf den recht geringen Energieverbrauch, das unnötige Enzym herzustellen). menschlichen Zellen findet man haufenweise Relikte, die durch Mutationen funktionslos wurden. Die VitA Mutation schadete dem Menschen nicht recht (außer den Menschen, die kein vitaminA mit der Nahrung aufnahmen).

DIY Golden Rice – genes

Long time no write. This post will soon decipher the genes needed to turn normal rice into Golden Rice. Golden Rice produces Beta-Carotene, which is a direct precursor to VitaminA. 20.000 people a day die because of vitamin A deficiency (which is a horrbile death btw, because you become blind first). Why not produce VitaminA? First the human body can produce VitA from Beta-carotene. It would be adding an unneccesary gene to the construct. Secondly, and more importantly, you cannot overdose beta-carotene. If you eat too much vitA you can get intoxication – if ou eat too much beta-carotene your body disposes of it with the urine.

https://www.ncbi.nlm.nih.gov/nuccore/X78814

https://www.ncbi.nlm.nih.gov/nuccore/22474502

https://www.ncbi.nlm.nih.gov/nuccore/1419692

Here is the paper describing the newly engineered pathway.

These are the three genes we need – Psy, Crtl, Lyc.

 

vitA pathway.jpg

figure from the open access paper from The American Society for Nutritional Sciences

 

Plant cells already contain GGPP (Geranylgeranyl pyrophosphate) – it is a pretty important molecule that is the basis of many other pathways. So as you see we need to add a Phytoene Synthase gene which codes for the protein enzyme Phytoene Synthase which turns the plant cells’ GGPP into Phytoene. Usually plants employ two enzymes to go from Phytoene to Lycopene (Lycopene is e.g. one of the healthy compounds in tomatoes) but here we take a shortcut: a characterized bacterial gene Crtl can do this in one step. Last step is an enzyme that converts Lycopene into Beta-Carotene, hence we need a lycopene cyclase.

Each enzyme does one job only – enzymes work like key lock systems. The precursor molecules fit into the cavity or “active center” in the protein enzyme and the enzyme catalyzes their specific reaction. Whatever the media fearmongered you – there are no unforseen side-effects in this regard. Unlike chemical synthesis (where catalysis can e.g. be done at 120°C in sulfuric acid) the enzyme is VERY specific.

 

A little not at the end of this post: Our far-far ancestors’ bodies were actually able to produce vitamin A themselves.We still have the enzymes in our chromosomal DNA – but there was a mutation that rendered our vitaminA biosynthesis proteins useless. Unlike in horror movies, these mutations don’t made them zombies though. The enzyme’s structure was just destroyed, and the precursor molecule wouldn’t fit in anymore. So speaking, human cells have lots of “corpse-proteins” in them that lost their function but are still expressed. The cell doesn’t know what function proteins have so they keep producing even the mutated forms. Obviosly this wasn’t of harm to us – unless we didn’t eat enough vitamin A.

Wild-type Agrobaterium

20150120_124859 20150120_125004

Agrobacterium is probably one of the most famous and oldest genetic engineers. It injects a marked piece of its “Ti-Plasmid” into plant cells. The inserted sequence codes for a growth hormone (to make the plant produce this “tumors”, but it does not have much to do with cancer. Just unregulated growth of these plant cells)  and a gene to make the plant produce a special nutrient, that many other bacteria cannot digest. Thus it programs the plant to give it shelter and food. Smart bug.

 

For the GFP plant, a lab strain of this bacterium was taken. The marked piece of DNA, that it usually injects into plants was deleted (disarmed strain) and later replaced with the GFP gene. So the only gene it could possibly inject is the sequence we provide it with in pGreenII.

Instruction: DIY Genetically engineered plants

Was thinking if it would sense to make a picture-based instruction on how to genetically engineer plants in a diy setting. The pictures are from the experiments I did in the Ars Electronica Lab.
To show people this is not black magic at all, and everyone can do it. Also read in the “synbio for beginners pdf” I wrote to learn how the DNA desgin is done.

Transient Transformation of tobacco with green fluorescent protein DNA:

In this experiment, we first transformed tobacco with a pGreen-derived GFP vector. Thus a gene envcoding GFP is inserted into the genetic material (chromosome) of a plant.
The plant cells then produce the green fluorescent protein. That means, if you put the plants under UV-light, the protein absorbs the UV light and emits green light.
GFP is often used as a proof-of-concept to show your transformation method worked.

http://www.pgreen.ac.uk/JIT/pGreen0000_fr.htm pGreen is a Ti-plasmid. It encodes a gene (ori) that make it replicate in bacteria (else the bacterial cell divides into two cells, and just one carries the plasmid), a resistance against the antibiotic kanamycin (so you kan kill all bacteria that haven’t taken up the plasmid by putting them into kanamycin). Then there is left border and right border (25 letters long) which are recognized by the bacterium. It ~”cuts out” the DNA between the borders and shoots it into plant cells (in our case there’s just a “always on” promoter, GFP and terminator inbetween). No other DNA is transferred, so you get a well defined outcome.

 

The plasmid DNA was inserted into agrobacterium with CaCl2-heat shock and then added some sterile LB. After one hour (time for the agrobacterium to express kanamycin resistance proteins) the bacteria were then plated out on LB-Kanamycin agar in a petri dish.

SAMSUNG

A colony was picked and transferred into LB+Kanamycin liquid medium.  The medium was then placed horizontally for 2 days to allow the bacteria to grow. The horizontal position increased the surface, so that the bacteria got more oxygen.

SAMSUNG

After two days (the bacteria multiplied in the medium), a plant was infiltrated with drops of the agrobacterium. Therefore, the tubes were centrifuged (6000 RPM, 5 minutes). The supernatant was discarded. Fresh LB was added, and some acetosyringone, and vanillin sugar, respectively. AS and vanillin are phenolic compounds, which are a wound signal of plants. Agrobacterium “smells” these compounds and the virulence genes are upregulated.

SAMSUNG

 

After 5 days, we had a look at the plant (in the box) under UV light, but saw no glowing. After 7 days we opened the box, and it was fluorescent. The magenta box seemed to have filtered out the UV light.

SAMSUNG

The leaves seem a bit reddish due to weak chlorophyll autofluorescence. The green spots are the places where agrobacterium touched the plants, there it inserted the gene for the fluorescence protein.

Shown is also a native, wild-type (untransformed) leaf, which is just red.

I was later told that usually you infiltrate the bottom of the leaves, where it has holes for breathing (stoma), while on the top it has fibers to protect it from pests (such as agrobacterium :P  ). So, my friend told me it was a miracle I got some glow anyway. Could have been a lot brighter if we had applied the bacteria solution onto the leaves’ downsides.

SAMSUNG

We infiltrated bigger plants that way, and it just worked again.

 

 

pflanze gfp

(Thanks to T. Moravec, IEB, Prague for providing the DNA).

 

Hope you enjoyed it. Try it at home, kids (unless your government doesn’t allow it).  Then try it in a lab.
Add insuline gene or whatever protein you want the plant to produce. Epo?

synthetische Biologie und Gentechnik für Anfänger

Tags

, , , ,

Gentechnik für Anfänger 1

Hier die pdf Datei (einfach anklicken) – viel besser lesbar als die Onlineversion unten (mit Farben zum besseren Verständnis)

Bitte entschuldigt die Ausdrucksweise “Dummies”😀  http://de.wikipedia.org/wiki/F%C3%BCr_Dummies

___________________________________________________________________________

http://www.welt.de/kultur/article125606862/Man-spricht-nicht-mehr-deutsch.html

Deutsch hat eindeutig seine Rolle in der Wissenschaft verloren. Ein sehr guter Artikel!

Das, unter ielen anderen Faktoren, führt uns schließlich zu diesem Problem:

http://www.welt.de/debatte/kommentare/article126487997/Warum-die-besten-Koepfe-Deutschland-verlassen.html

Viele kluge Köpfe wandern aus dem deutschsprachigen Raum ab. Ein anderer Grund ist auch, dass das „gemeine Volk“ schlichtweg Angst vor Wissenschaftlern hat. Das kommt auch davon, dass sie die Wissenschaft nicht verstehen (weil die wissenschaftlichen Arbeiten in Englisch verfasst sind? Ein Teufelskreis). In Filmen werden sie hauptsächlich als die Bösen dargestellt.

„Wenn ich auf einer Party erzähle, dass ich Vorlesungen in Kernphysikbesucht habe, dann glauben die Leute sofort, ich würde in meinem Hobbykeller Plutonium anreichern. Das stimmt natürlich, aber was ist daran so schlimm?“

 

„In einem Land, das Studiengänge für Homöopathie einrichtet, das die Angst vor Gentechnik, Elektrosmog, Pestiziden, Schutzimpfungen, Stammzellenforschung, Kernenergie und Fracking bis ins Paranoide erhöht – in diesem Land sehen viele exzellente Wissenschaftler einfach keine Perspektive mehr.“

(Zitate aus dem Artikel)

 

 

Darum übersetze ich die Einstiegshilfe „Gentechnik und synthetische Biologie für Dummies“ ins Deutsche, um meinen Teil zu tun.

 

 

Genetic engineering and synbio for „dummies“

 

Eine immer wieder gestellte Frage ist “wie kann ich mit Gentechnik anfangen?”.

Hier ist das Grundlagenwissen dazu, um über gentechnische Fragen mündig mitreden zu können.

 

Die erste Frage, die wir uns stellen müssen, ist: Wie speichert eine Zelle Informationen?

Fangen wir mit einem Bakterium an, weil es ein sehr einfacher Organismus ist (die Regeln gelten aber genau so für alle Zellen – Pflanzen, Säugetierzellen, Pilze, …).

Unser Bakterium besitzte ein sehr großes Molekül doppelsträngiger DNA (genannt das Chromosom), die die gesamte Informationen enthält, die es zum Leben braucht. Also, den Bauplan für Enzyme (Biokatalysatoren) die Zucker abbauen (um Energie zu gewinnen), um Zellulose aus einfachen Zuckern aufzubauen, die Fettsäuren in Fett-Esther (z.B. für Verrwendung in der Kosmetik oder als Biotreibstoff) umwandeln, und tausende anderer Enzyme.

Bakterien können aber auch Plasmide tragen. Plasmide sind kleine, ringförmige DNA Moleküle (also quasi Mini-Chromosomen) und enthalten Informationen, die fürs Leben nicht  unbedingt notwendig sind – aber sie können z.B. Antibiotikaresistenzen tragen.Oder andere vorteilhafte Gene. Am besten lässt sich die Analogie zum Computer beschreiben:

Das Chromosom ist die Festplatte des Computers, die alle wichtigen Informationen (Systemdateien von Windows/Linux/ etc. ) enthält und ohne die der Computer nicht geht. Und Plasmide sind wie USB Sticks, sie tragen nur kleine Mengen an Informationen und sind zwischen mehreren Computern hin- und her austauschbar.

 

Jetzt die wichtigste Information: Der einzige Sinn und Zweck der DNA ist es, Proteine (lange Ketten von Aminosäuren, Daumenregel 200-300 Aminosäuren hintereinander ergeben ein Protein) herzustellen.  Die DNA macht praktisch nichts anderes, sie ist nur ein Code der Informationen speichert. Die erzeugen Proteine können dann z.B. als Enzyme arbeiten  (um  Substanz A in Substance B  zu verwandeln – z.B Zucker in Biodiesel, oder Zellulose zu Glucose abbauen), ein paar besondere Proteine leuchten stark wenn man sie mit UV-Licht anleuchtet, und andere Proteine werden als Stützmateriale der Zelle verwendet (Sprich mechanisches Baumaterial), etc.  Menschliches Wachstumshormon ist ein Protein, oder EPO (um besser Radfahren zu können).

 

Also – fangen wir mit der praktischen Arbeit an. Dafür nehmen wir ein Bakterium, das gut erforscht ist und nicht Krankheitserregend. Wie z.B. einen sicheren Laborstamm von E.coli. Diesem wollen wir jetzt den genetischen Bauplan für ein grün fluoreszierendes Protein (GFP aus einer Qualle) einbauen. Wenn das Bakterium unseren Bauplan aufgenommen hat, und wenn es den Bauplan auch umsetzt, dann wird das Bakterium unter UV-Licht grün leuchten . und wir sehen, dass unser Experiment funktioniert hat (weil ein normales Bakterium daneben nicht grün leuchtet).

 

Ein DNA-Strang ist eine Aneinanderreihung der vier Basen: A,T,G,C.

Der Bauplan für GFP ist folgender:

atgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

Die DNA (Speichermedium) wird zuerst abgelesen und eine RNA (Arbeitskopie) mit der selben Sequenz erzeugt (die Arbeit erledigt die RNA-Polymerase). Die DNA wird in Richtung 5‘ -> 3‘ abgelesen – das muss man zu diesem Zeitpunkt aber noch nicht verstehen. Sprich, die Polymerase weiß aufgrund unserer Sequenz in welche Richtung sie welchen Strang ablesen muss.

Diese RNA wird aus unserer GFP-DNA erzeugt.

 

AUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

 

Jetzt wir daraus Protein erzeugt. Die Ribosomen erledigen die Arbeit und lesen die RNA ab als

AUG-AGU-AAG-GGA-GAA-GAA-CUU-UUC-ACU-GGA-GUU-GUC-CCA-…. und so weiter.

 

Nach diesem Bauplan erzeugen die Ribosomen, Aminosäure nach Aminosäure, eine lineare Aminosäurekette (Die sich dann aufgrund der Zusammentsetzung zusammenfaltet – bestimmte Aminosäuren ziehen andere an usw. Für uns jetzt unwichtig, da wir ja wissen das das Protein in der Natur mit diesem Bauplan funktioniert!). ATG heißt “Start” und codiert für die Aminosäure Methionine (m). Das Ribosom gleitet dann zum nächsten Triplet  (“Codon”) AGU. Das codiert für  die Aminosäure Serin (s). Dann kommt AAG welches das Ribosom als die Aminosäure Lysine (k) erkennt. …etc.

Urheberrechtlich ungeschütztes Bild von “codon wheel” einfügen.

m-s-k-g-e-e-l-f-t-g-v-v-p-… und so weiter

Wir bekommen also eine Aminosäurenkette (ein Protein) mit dieser Zusammensetzung:

mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttfayglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk

Die Protein Synthese startet immer mit einem ATG. Und stoppt bei TAG, TAA oder TGA.

 

 

Soweit sind wir durch  – das war die große Hexerei, wie Lebewesen funktionieren und wie Gentechnik funktioniert. Im Groben.

 

Nun müssen wir noch eine Ribosomen Bindungsstelle (hier rot eingezeichnet) einfügen. Diese muss kurz vor dem ATG sein. (zumindest aber 4 basen/”Nucleotide” weit weg!). Die “consensus sequence” (~in der Natur am häufigsten) dafür ist AGGAGG. Also fügen wir hinzu:

 

TCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

 

Das ganze wird dann zu RNA:

 

UCAGGAGGUAGUAAUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

 

Die exakte Sequenz der anderen Basen (schwarze Buchstaben) spielt eigentlich keine Rolle, sie dürfen nur nicht zu stark mit der  ribosome binding site (vermeide eher  C und T) interagieren (sonst verflechtet sich die RNA und wird nicht abgelesen).

Jedenfalls, die „Untranslated RNA“, also der Anteil der nicht zu Protein abgelesen wird trägt nichts zu der Sequenz – also auch nicht zur Funktion – des Proteins bei.

Höchstens dazu, wie oft die RNA abgelesen wird – dh. Wie viel Protein wir bekommen.

 

Jetzt wo wir diese RNA in unserer Zelle haben,die eine Ribosomen Bindungsstelle enthält, wird nach deren Vorbild ein Protein erzeugt, dass unter UV-Licht grün leuchtet (fluoresziert).

 

Das letzte Bisschen, was wir noch brauchen: nicht jede DNA wird auch zu RNA abgelesen. Das selbe, wenn man einen Bauplan für einen Stuhl zum Tischler bringt – das heißt nicht, dass er auch zu Arbeiten beginnt. (Die Information (DNA) liegt erst mal herum und wird nicht abgelesen). Man muss dem Tischler sagen, dass er zu Arbeiten anfangen soll. Und wieviele Stühle man braucht.

 

Nicht jede DNA wird auch zu RNA abgelesen.Was uns noch fehlt ist ein Promoter. Ein Promoter ist eine Spzielle DNA Sequenz, die der DNA eine spezielle Struktur verleiht, an die die RNA-Polymerase binden kann. Die  Polymerase liest dann die DNA ab und erzeugt RNA mit der entsprechenden Sequenz. Der Promoter sagt der Zelle auch, zu welchen Zeitpunkt das dahinterliegende Gen angeschaltet wird. (inducible Promoter / oder „always on“): Kein Promoter heißt „Nie an“.. Ein “konstitutiver” Promoter heißt “immer an”. Lactose-induzierbarer Promoter heißt “nur an, wenn in der Zelle Milchzucker ist”. Etc.

Schlussendlichbnraucht man dann noch einen Terminator – das ist eine Struktur,  die der RNA polymerase sagt, sie soll aufhören RNA zu machen. Sonst würde ja die gesamte DNA abgelese werden, und noch dazu ist sie ja Ringförmis, dh. die Polymerase würde ständig ablesen und idas gesamte Genom mehrmals umkreisen.

 

Damit haben wir unser fix-fertiges Konstrukt, das man in Bakterien verweden kann, um das Protein zu erzeugen:

Promoter- ribosome binding site- ATG – code – TAG – Terminator.

 

Ein constitutive promoter (von iGEM) ttgacagctagctcagtcctaggtattgtgctagc.

 

Also nehmen wir: ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

 

Das erste, dunkelgrüne Segment ist der Promoter. Die blaue Sequence ist “untranslated region” (RNA die nicht zu Protein abgelesen  wird). Außerdem haben wir noch ein paar Basen hinzugefügt. tctaga ist eine Sequenz, die von einem Restriktionsenzym erkannt wird – XbaI. Dieses schneidet die DNA nur an den vorherbestimmten Stellen  (hilfreich wenn man nachher z.B. noch einen anderen Promoter anhängen will)

 

Ein Terminator, der in E.Coli funktioniert, ist:

AGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

http://parts.igem.org/Part:BBa_B0011 here you see the structure of it. AAAA binds to TTTT and somehow transcription of DNA into RNA is aborted. Es bildet sich irgendwie eine Schleife zwischen den AAA und TTT und damit hört die Transkription auf. Zerbrechen wir uns jetzt mal nicht den Kopf darüber, wie genau das funktioniert. Es funktioniert, darum können wir es verwenden😉 Falls das jemanden interessiert, einfach nach „rho-independent terminator“ googlen.

 

 

Somit haben wir

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

 

In dieser Form kann die Zelle die DNA lessen und in RNA ablesen und diese in Protein ablesen.

Kurz: Polymerase bindet an den promoter structure, und startet RNA Synthese. RNA Synthese stoppt beim Terminator. Jetzt haben wir einen RNA Strang, der in der Zelle herum”schwebt” bzw treibt. Irgendwann trifft ein Ribosom auf die RNA und bindet an die ribosome binding site , und findet daraufhin das ATG. Dort beginnt es mit der Protein Synthese. Viel RNA (starker Promoter) heißt, man bekommt viel Protein.

 

Das Protein ist es, was wir wollen.Es erfüllt die biologische Funktion – also z.B. Leuchten unter UV-Licht, oder als Enzym (Katalysator) um Substanzen (wie Zucker, Fette, …) umzuwandeln in andere Substancen. Oder die Proteine fungieren als Hormone (Man denke an Insulin).

Wenn man will, dass man das selbe Protein jetzt nicht in E.Coli sondern in Bacillus subtilis erzeugt, tauscht man einfach den E. coli Promoter gegen einen  Bacillus promoter (und Terminator, für den Fall, dass der E.coli Terminator in Bacillus nicht funktioniert). Wenn man will, dass es in Pflanzen funktionioert, fügen man einen Pflanzen Promoter und Pflanzen Terminator hinzu. (Und die ribosome binding site sollte ein bisschen anders aussehen: Kozak sequence – um viel Protein zu erzeugen)

 

 

 

 

Nun muss man die DNA nurmehr in ein Bakterium bnringen.  Sobald es in der Zelle drinnen ist, wird die DNA erkannt.

Allerdings haben wir hier jetzt ein lineares DNA Molekül. Teilt sich das Bakterium, dann wird diese lineare DNA nicht mitvermehrt. Das Bakterium teilt sich in zwei „Tochterzellen“ von denen dann nur eine unsere DNA tragen würde.

Außerdem:Zellen mögen keine lineare DNA (Virusverdacht!) und bauen diese sofort gezielt ab (beginnend an den freien Enden). Darum schneidet man die DNA in ein naürlich vorkommendes Plasmid, dann bleibnt die DNA in der Zell stabil und wird gezielt mitvermehrt. (Das Plasmid hat dazu einen “Replication Origin” oder Vermehrungsstartpunkt. Dort kann DNA Polymerase ansetzen und das Plamsid vermehren). Außerdem tragen Plasmide oft eine Antibiotikum-Resistenz, dass man die Zellen damit selektieren kann.

 

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgNNNNNNNNtaaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

 

So könnte unsere Antibiotikumresistenz aussehen:  NNNN steht für den gentischen Code des Enzymes, das das Antibiotikum in eine ungifitige Substanz umwandelt bzw. zerstört.

 

 

Wie bringe ich dieses neue (rekombinante) Plasmid jetzt in ein Bakterium? Mit einer feinen Nadel reinstechen, wie es der Volksmund gerne glaubt?

Nein, einfacher. Man hat eine Lösung mit Millionenn von identen Plasmiden, und eine andere Lösung mit Millionen von Bakterien. Denen gibt man dann einen kurzen Hitzeschock (bei 42°C), dabei gehen ihre Zellwände auf und die DNA kann einfließen. Von den Millionen Bakterien hat aber nur ein kleiner Teil, sagen wir 100 Zellen, das Plasmid aufgenommen. Sprich wir haben 100 Zellen die leuchten (oder Insulin  produzieren) unter Millionen die „natürlich“ sind und die DNA nicht aufgenommen haben.

Dafür haben wir jetzt unsere Antibiotikumresistenz. Setzen wir die Millionen von Bakterien diesem Antibiotikum aus – sterben alle ab bis auf die Bakterien, die das Plasmid tragen. Diese vermehren sich dann – und vermehren auch das Plasmid mit.

 

Plasmide sind allerdings nichtextrem stabil – man muss die Bakterien immer im Antibotikum-haltigen Nährmedium halten, sonst geht irgendwann das Plasmid verloren. Dann ist die Bakterienzelle auch wieder empflindlich gegen das Antibiotikum.