Tags

, , , ,

Gentechnik für Anfänger 1

Hier die pdf Datei (einfach anklicken) – viel besser lesbar als die Onlineversion unten (mit Farben zum besseren Verständnis)

Bitte entschuldigt die Ausdrucksweise “Dummies” 😀  http://de.wikipedia.org/wiki/F%C3%BCr_Dummies

___________________________________________________________________________

http://www.welt.de/kultur/article125606862/Man-spricht-nicht-mehr-deutsch.html

Deutsch hat eindeutig seine Rolle in der Wissenschaft verloren. Ein sehr guter Artikel!

Das, unter ielen anderen Faktoren, führt uns schließlich zu diesem Problem:

http://www.welt.de/debatte/kommentare/article126487997/Warum-die-besten-Koepfe-Deutschland-verlassen.html

Viele kluge Köpfe wandern aus dem deutschsprachigen Raum ab. Ein anderer Grund ist auch, dass das „gemeine Volk“ schlichtweg Angst vor Wissenschaftlern hat. Das kommt auch davon, dass sie die Wissenschaft nicht verstehen (weil die wissenschaftlichen Arbeiten in Englisch verfasst sind? Ein Teufelskreis). In Filmen werden sie hauptsächlich als die Bösen dargestellt.

„Wenn ich auf einer Party erzähle, dass ich Vorlesungen in Kernphysikbesucht habe, dann glauben die Leute sofort, ich würde in meinem Hobbykeller Plutonium anreichern. Das stimmt natürlich, aber was ist daran so schlimm?“

 

„In einem Land, das Studiengänge für Homöopathie einrichtet, das die Angst vor Gentechnik, Elektrosmog, Pestiziden, Schutzimpfungen, Stammzellenforschung, Kernenergie und Fracking bis ins Paranoide erhöht – in diesem Land sehen viele exzellente Wissenschaftler einfach keine Perspektive mehr.“

(Zitate aus dem Artikel)

 

 

Darum übersetze ich die Einstiegshilfe „Gentechnik und synthetische Biologie für Dummies“ ins Deutsche, um meinen Teil zu tun.

 

 

Genetic engineering and synbio for „dummies“

 

Eine immer wieder gestellte Frage ist “wie kann ich mit Gentechnik anfangen?”.

Hier ist das Grundlagenwissen dazu, um über gentechnische Fragen mündig mitreden zu können.

 

Die erste Frage, die wir uns stellen müssen, ist: Wie speichert eine Zelle Informationen?

Fangen wir mit einem Bakterium an, weil es ein sehr einfacher Organismus ist (die Regeln gelten aber genau so für alle Zellen – Pflanzen, Säugetierzellen, Pilze, …).

Unser Bakterium besitzte ein sehr großes Molekül doppelsträngiger DNA (genannt das Chromosom), die die gesamte Informationen enthält, die es zum Leben braucht. Also, den Bauplan für Enzyme (Biokatalysatoren) die Zucker abbauen (um Energie zu gewinnen), um Zellulose aus einfachen Zuckern aufzubauen, die Fettsäuren in Fett-Esther (z.B. für Verrwendung in der Kosmetik oder als Biotreibstoff) umwandeln, und tausende anderer Enzyme.

Bakterien können aber auch Plasmide tragen. Plasmide sind kleine, ringförmige DNA Moleküle (also quasi Mini-Chromosomen) und enthalten Informationen, die fürs Leben nicht  unbedingt notwendig sind – aber sie können z.B. Antibiotikaresistenzen tragen.Oder andere vorteilhafte Gene. Am besten lässt sich die Analogie zum Computer beschreiben:

Das Chromosom ist die Festplatte des Computers, die alle wichtigen Informationen (Systemdateien von Windows/Linux/ etc. ) enthält und ohne die der Computer nicht geht. Und Plasmide sind wie USB Sticks, sie tragen nur kleine Mengen an Informationen und sind zwischen mehreren Computern hin- und her austauschbar.

 

Jetzt die wichtigste Information: Der einzige Sinn und Zweck der DNA ist es, Proteine (lange Ketten von Aminosäuren, Daumenregel 200-300 Aminosäuren hintereinander ergeben ein Protein) herzustellen.  Die DNA macht praktisch nichts anderes, sie ist nur ein Code der Informationen speichert. Die erzeugen Proteine können dann z.B. als Enzyme arbeiten  (um  Substanz A in Substance B  zu verwandeln – z.B Zucker in Biodiesel, oder Zellulose zu Glucose abbauen), ein paar besondere Proteine leuchten stark wenn man sie mit UV-Licht anleuchtet, und andere Proteine werden als Stützmateriale der Zelle verwendet (Sprich mechanisches Baumaterial), etc.  Menschliches Wachstumshormon ist ein Protein, oder EPO (um besser Radfahren zu können).

 

Also – fangen wir mit der praktischen Arbeit an. Dafür nehmen wir ein Bakterium, das gut erforscht ist und nicht Krankheitserregend. Wie z.B. einen sicheren Laborstamm von E.coli. Diesem wollen wir jetzt den genetischen Bauplan für ein grün fluoreszierendes Protein (GFP aus einer Qualle) einbauen. Wenn das Bakterium unseren Bauplan aufgenommen hat, und wenn es den Bauplan auch umsetzt, dann wird das Bakterium unter UV-Licht grün leuchten . und wir sehen, dass unser Experiment funktioniert hat (weil ein normales Bakterium daneben nicht grün leuchtet).

 

Ein DNA-Strang ist eine Aneinanderreihung der vier Basen: A,T,G,C.

Der Bauplan für GFP ist folgender:

atgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

Die DNA (Speichermedium) wird zuerst abgelesen und eine RNA (Arbeitskopie) mit der selben Sequenz erzeugt (die Arbeit erledigt die RNA-Polymerase). Die DNA wird in Richtung 5‘ -> 3‘ abgelesen – das muss man zu diesem Zeitpunkt aber noch nicht verstehen. Sprich, die Polymerase weiß aufgrund unserer Sequenz in welche Richtung sie welchen Strang ablesen muss.

Diese RNA wird aus unserer GFP-DNA erzeugt.

 

AUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

 

Jetzt wir daraus Protein erzeugt. Die Ribosomen erledigen die Arbeit und lesen die RNA ab als

AUG-AGU-AAG-GGA-GAA-GAA-CUU-UUC-ACU-GGA-GUU-GUC-CCA-…. und so weiter.

 

Nach diesem Bauplan erzeugen die Ribosomen, Aminosäure nach Aminosäure, eine lineare Aminosäurekette (Die sich dann aufgrund der Zusammentsetzung zusammenfaltet – bestimmte Aminosäuren ziehen andere an usw. Für uns jetzt unwichtig, da wir ja wissen das das Protein in der Natur mit diesem Bauplan funktioniert!). ATG heißt “Start” und codiert für die Aminosäure Methionine (m). Das Ribosom gleitet dann zum nächsten Triplet  (“Codon”) AGU. Das codiert für  die Aminosäure Serin (s). Dann kommt AAG welches das Ribosom als die Aminosäure Lysine (k) erkennt. …etc.

Urheberrechtlich ungeschütztes Bild von “codon wheel” einfügen.

m-s-k-g-e-e-l-f-t-g-v-v-p-… und so weiter

Wir bekommen also eine Aminosäurenkette (ein Protein) mit dieser Zusammensetzung:

mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttfayglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk

Die Protein Synthese startet immer mit einem ATG. Und stoppt bei TAG, TAA oder TGA.

 

 

Soweit sind wir durch  – das war die große Hexerei, wie Lebewesen funktionieren und wie Gentechnik funktioniert. Im Groben.

 

Nun müssen wir noch eine Ribosomen Bindungsstelle (hier rot eingezeichnet) einfügen. Diese muss kurz vor dem ATG sein. (zumindest aber 4 basen/”Nucleotide” weit weg!). Die “consensus sequence” (~in der Natur am häufigsten) dafür ist AGGAGG. Also fügen wir hinzu:

 

TCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

 

Das ganze wird dann zu RNA:

 

UCAGGAGGUAGUAAUGAGUAAGGGAGAAGAACUUUUCACUGGAGUUGUCCCAAUUCUUGUUGAAUUAGAUGGUGAUGUUAAUGGGCACAAAUUUUCUGUCAGUGGAGAGGGUGAAGGUGAUGCAACAUACGGAAAACUUACCCUUAAAUUUAUUUGCACUACUGGAAAACUACCUGUUCCAUGGCCAACACUUGUCACUACUUUCGCGUAUGGUCUUCAAUGCUUUGCGAGAUACCCAGAUCAUAUGAAACGGCAUGACUUUUUCAAGAGUGCCAUGCCCGAAGGUUAUGUACAGGAAAGAACUAUAUUUUUCAAAGAUGACGGGAACUACAAGACACGUGCUGAAGUCAAGUUUGAAGGUGAUACCCUUGUUAAUAGAAUCGAGUUAAAAGGUAUUGAUUUUAAAGAAGAUGGAAACAUUCUUGGACACAAAUUGGAAUACAACUAUAACUCACACAAUGUAUACAUCAUGGCAGACAAACAAAAGAAUGGAAUCAAAGUUAACUUCAAAAUUAGACACAACAUUGAAGAUGGAAGCGUUCAACUAGCAGACCAUUAUCAACAAAAUACUCCAAUUGGCGAUGGCCCUGUCCUUUUACCAGACAACCAUUACUUGUCCACACAAUCUGCCCUUUCGAAAGAUCCCAACGAAAAGAGAGACCACAUGGUCCUUCUUGAGUUUGUAACAGCUGCUGGGAUUACACAUGGCAUGGAUGAACUAUACAAAUAA

 

Die exakte Sequenz der anderen Basen (schwarze Buchstaben) spielt eigentlich keine Rolle, sie dürfen nur nicht zu stark mit der  ribosome binding site (vermeide eher  C und T) interagieren (sonst verflechtet sich die RNA und wird nicht abgelesen).

Jedenfalls, die „Untranslated RNA“, also der Anteil der nicht zu Protein abgelesen wird trägt nichts zu der Sequenz – also auch nicht zur Funktion – des Proteins bei.

Höchstens dazu, wie oft die RNA abgelesen wird – dh. Wie viel Protein wir bekommen.

 

Jetzt wo wir diese RNA in unserer Zelle haben,die eine Ribosomen Bindungsstelle enthält, wird nach deren Vorbild ein Protein erzeugt, dass unter UV-Licht grün leuchtet (fluoresziert).

 

Das letzte Bisschen, was wir noch brauchen: nicht jede DNA wird auch zu RNA abgelesen. Das selbe, wenn man einen Bauplan für einen Stuhl zum Tischler bringt – das heißt nicht, dass er auch zu Arbeiten beginnt. (Die Information (DNA) liegt erst mal herum und wird nicht abgelesen). Man muss dem Tischler sagen, dass er zu Arbeiten anfangen soll. Und wieviele Stühle man braucht.

 

Nicht jede DNA wird auch zu RNA abgelesen.Was uns noch fehlt ist ein Promoter. Ein Promoter ist eine Spzielle DNA Sequenz, die der DNA eine spezielle Struktur verleiht, an die die RNA-Polymerase binden kann. Die  Polymerase liest dann die DNA ab und erzeugt RNA mit der entsprechenden Sequenz. Der Promoter sagt der Zelle auch, zu welchen Zeitpunkt das dahinterliegende Gen angeschaltet wird. (inducible Promoter / oder „always on“): Kein Promoter heißt „Nie an“.. Ein “konstitutiver” Promoter heißt “immer an”. Lactose-induzierbarer Promoter heißt “nur an, wenn in der Zelle Milchzucker ist”. Etc.

Schlussendlichbnraucht man dann noch einen Terminator – das ist eine Struktur,  die der RNA polymerase sagt, sie soll aufhören RNA zu machen. Sonst würde ja die gesamte DNA abgelese werden, und noch dazu ist sie ja Ringförmis, dh. die Polymerase würde ständig ablesen und idas gesamte Genom mehrmals umkreisen.

 

Damit haben wir unser fix-fertiges Konstrukt, das man in Bakterien verweden kann, um das Protein zu erzeugen:

Promoter- ribosome binding site- ATG – code – TAG – Terminator.

 

Ein constitutive promoter (von iGEM) ttgacagctagctcagtcctaggtattgtgctagc.

 

Also nehmen wir: ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataa

 

Das erste, dunkelgrüne Segment ist der Promoter. Die blaue Sequence ist “untranslated region” (RNA die nicht zu Protein abgelesen  wird). Außerdem haben wir noch ein paar Basen hinzugefügt. tctaga ist eine Sequenz, die von einem Restriktionsenzym erkannt wird – XbaI. Dieses schneidet die DNA nur an den vorherbestimmten Stellen  (hilfreich wenn man nachher z.B. noch einen anderen Promoter anhängen will)

 

Ein Terminator, der in E.Coli funktioniert, ist:

AGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

http://parts.igem.org/Part:BBa_B0011 here you see the structure of it. AAAA binds to TTTT and somehow transcription of DNA into RNA is aborted. Es bildet sich irgendwie eine Schleife zwischen den AAA und TTT und damit hört die Transkription auf. Zerbrechen wir uns jetzt mal nicht den Kopf darüber, wie genau das funktioniert. Es funktioniert, darum können wir es verwenden 😉 Falls das jemanden interessiert, einfach nach „rho-independent terminator“ googlen.

 

 

Somit haben wir

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgagtaagggagaagaacttttcactggagttgtcccaattcttgttgaattagatggtgatgttaatgggcacaaattttctgtcagtggagagggtgaaggtgatgcaacatacggaaaacttacccttaaatttatttgcactactggaaaactacctgttccatggccaacacttgtcactactttcgcgtatggtcttcaatgctttgcgagatacccagatcatatgaaacggcatgactttttcaagagtgccatgcccgaaggttatgtacaggaaagaactatatttttcaaagatgacgggaactacaagacacgtgctgaagtcaagtttgaaggtgatacccttgttaatagaatcgagttaaaaggtattgattttaaagaagatggaaacattcttggacacaaattggaatacaactataactcacacaatgtatacatcatggcagacaaacaaaagaatggaatcaaagttaacttcaaaattagacacaacattgaagatggaagcgttcaactagcagaccattatcaacaaaatactccaattggcgatggccctgtccttttaccagacaaccattacttgtccacacaatctgccctttcgaaagatcccaacgaaaagagagaccacatggtccttcttgagtttgtaacagctgctgggattacacatggcatggatgaactatacaaataaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

 

In dieser Form kann die Zelle die DNA lessen und in RNA ablesen und diese in Protein ablesen.

Kurz: Polymerase bindet an den promoter structure, und startet RNA Synthese. RNA Synthese stoppt beim Terminator. Jetzt haben wir einen RNA Strang, der in der Zelle herum”schwebt” bzw treibt. Irgendwann trifft ein Ribosom auf die RNA und bindet an die ribosome binding site , und findet daraufhin das ATG. Dort beginnt es mit der Protein Synthese. Viel RNA (starker Promoter) heißt, man bekommt viel Protein.

 

Das Protein ist es, was wir wollen.Es erfüllt die biologische Funktion – also z.B. Leuchten unter UV-Licht, oder als Enzym (Katalysator) um Substanzen (wie Zucker, Fette, …) umzuwandeln in andere Substancen. Oder die Proteine fungieren als Hormone (Man denke an Insulin).

Wenn man will, dass man das selbe Protein jetzt nicht in E.Coli sondern in Bacillus subtilis erzeugt, tauscht man einfach den E. coli Promoter gegen einen  Bacillus promoter (und Terminator, für den Fall, dass der E.coli Terminator in Bacillus nicht funktioniert). Wenn man will, dass es in Pflanzen funktionioert, fügen man einen Pflanzen Promoter und Pflanzen Terminator hinzu. (Und die ribosome binding site sollte ein bisschen anders aussehen: Kozak sequence – um viel Protein zu erzeugen)

 

 

 

 

Nun muss man die DNA nurmehr in ein Bakterium bnringen.  Sobald es in der Zelle drinnen ist, wird die DNA erkannt.

Allerdings haben wir hier jetzt ein lineares DNA Molekül. Teilt sich das Bakterium, dann wird diese lineare DNA nicht mitvermehrt. Das Bakterium teilt sich in zwei „Tochterzellen“ von denen dann nur eine unsere DNA tragen würde.

Außerdem:Zellen mögen keine lineare DNA (Virusverdacht!) und bauen diese sofort gezielt ab (beginnend an den freien Enden). Darum schneidet man die DNA in ein naürlich vorkommendes Plasmid, dann bleibnt die DNA in der Zell stabil und wird gezielt mitvermehrt. (Das Plasmid hat dazu einen “Replication Origin” oder Vermehrungsstartpunkt. Dort kann DNA Polymerase ansetzen und das Plamsid vermehren). Außerdem tragen Plasmide oft eine Antibiotikum-Resistenz, dass man die Zellen damit selektieren kann.

 

ggatccttgacagctagctcagtcctaggtattgtgctagctctagatttagtctTCAGGAGGTAGTAatgNNNNNNNNtaaTATAGTCGTAGATCTAGAGAATATAAAAAGCCAGATTATTAATCCGGCTTTTTTATTATTT

 

So könnte unsere Antibiotikumresistenz aussehen:  NNNN steht für den gentischen Code des Enzymes, das das Antibiotikum in eine ungifitige Substanz umwandelt bzw. zerstört.

 

 

Wie bringe ich dieses neue (rekombinante) Plasmid jetzt in ein Bakterium? Mit einer feinen Nadel reinstechen, wie es der Volksmund gerne glaubt?

Nein, einfacher. Man hat eine Lösung mit Millionenn von identen Plasmiden, und eine andere Lösung mit Millionen von Bakterien. Denen gibt man dann einen kurzen Hitzeschock (bei 42°C), dabei gehen ihre Zellwände auf und die DNA kann einfließen. Von den Millionen Bakterien hat aber nur ein kleiner Teil, sagen wir 100 Zellen, das Plasmid aufgenommen. Sprich wir haben 100 Zellen die leuchten (oder Insulin  produzieren) unter Millionen die „natürlich“ sind und die DNA nicht aufgenommen haben.

Dafür haben wir jetzt unsere Antibiotikumresistenz. Setzen wir die Millionen von Bakterien diesem Antibiotikum aus – sterben alle ab bis auf die Bakterien, die das Plasmid tragen. Diese vermehren sich dann – und vermehren auch das Plasmid mit.

 

Plasmide sind allerdings nichtextrem stabil – man muss die Bakterien immer im Antibotikum-haltigen Nährmedium halten, sonst geht irgendwann das Plasmid verloren. Dann ist die Bakterienzelle auch wieder empflindlich gegen das Antibiotikum.

Advertisements